FCGR3A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2552
Zusätzliche Namen:: CD16|CD16-II|CD16A|FCG3|FCGR3|FCGR3A|FCGRIII|FcGRIIIA|FCR-10|FCRIII|FCRIIIA|IGFR3|IMD20
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
Uniprot:: P08637
Synonyme:: CD16;CD16A;CD16a antigen;Fc fragment of IgG, low affinity III, receptor for (CD16);Fc fragment of IgG, low affinity IIIa, receptor (CD16a);Fc gamma receptor III-A;Fc-gamma receptor III-2 (CD 16);Fc-gamma receptor IIIb (CD16);Fc-gamma RIII-alpha;FCG3;FcgammaRIIIA;FCGR3;FCGRIII;FCR-10;FCRIII;FCRIIIA;IGFR3;igG Fc receptor III-2;IMD20;immunoglobulin G Fc receptor III;low affinity immunoglobulin gamma Fc region receptor III-A;low affinity immunoglobulin gamma receptor III-a Fc fragment;neutrophil-specific antigen NA
Weitere Details:: This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice