ABflo[R] 488 Rabbit anti-Mouse CD72 monoclonal antibody

Größe

Auf Anfrage

SKU:: A25518
Zusätzliche Namen:: CD72c|Ly-19|Ly-32|Ly-m19|Lyb-2
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DSSDTCCPCGWIPYQERCFYISHTLGSLEESQKYCTSLSSKLAAFDEPSKYYYEVSLPSGLEELLDRSKSYWIQMSKKWRQDSDSQSRHCVRIKTYYQKWERTISKCAELHPCICESEAFRFPDGINLN
Uniprot:: P21855
Synonyme:: B-cell differentiation antigen CD72;CD72 antigen;CD72b;CD72c;Ly-1;Ly-19;Ly-3;Ly-32;Ly-m1;Ly-m19;Lyb-;lyb-2;LYB2;lymphocyte antigen 32
Weitere Details:: Predicted to enable carbohydrate binding activity and transmembrane signaling receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in brain; cerebellum external granule cell layer; cerebellum internal granule cell layer; hippocampus; and neocortex. Orthologous to human CD72 (CD72 molecule).