IL-13 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25512
Zusätzliche Namen:: Il-13
Anwendung:: ELISA, Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Uniprot:: P20109
Synonyme:: Il-;IL-13;interleukin-13;P600;T-cell activation protein P600
Weitere Details:: Predicted to enable interleukin-13 receptor binding activity. Involved in positive regulation of cold-induced thermogenesis and positive regulation of macrophage activation. Acts upstream of or within cellular response to cytokine stimulus; inflammatory response; and positive regulation of immune effector process. Located in cytoplasm; external side of plasma membrane; and extracellular space. Is expressed in gut; liver; male reproductive gland or organ; and thymus. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); diffuse scleroderma; lung disease (multiple); and nose disease (multiple). Orthologous to human IL13 (interleukin 13).