GM-CSF Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25503
Zusätzliche Namen:: Gm-csf|Gmcsf
Anwendung:: ELISA, WB
Molekulargewicht:: 45-60kDa
Spezies-Reaktivität:: Rat
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Spezies:: Rat
Sequenz:: TRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Uniprot:: P48750
Synonyme:: colony stimulating factor 2 (granulocyte-macrophage);colony-stimulating factor;CSF;Gm-csf;GMCSF;granulocyte macrophage-colony stimulating factor;granulocyte-macrophage colony-stimulating factor;molgramostim;molgramostin;sargramostim
Weitere Details:: Enables cytokine activity. Involved in several processes, including cellular response to lipopolysaccharide; macrophage activation; and response to silicon dioxide. Located in extracellular space. Used to study Parkinsonism and myocardial infarction. Biomarker of abdominal aortic aneurysm; interstitial cystitis; and lung disease (multiple). Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2).