A25466
PCM1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25466
- Zusätzliche Namen:
- PCM1|PTC4|RET/PCM-1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 310kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI
- Uniprot:
- Q15154
- Synonyme:
- hPCM-1;PCM-1;pericentriolar material 1 protein;pericentriolar material 1, PCM1;PTC4;RET/PCM-1
- Weitere Details:
- The protein encoded by this gene is a component of centriolar satellites, which are electron dense granules scattered around centrosomes. Inhibition studies show that this protein is essential for the correct localization of several centrosomal proteins, and for anchoring microtubules to the centrosome. Chromosomal aberrations involving this gene are associated with papillary thyroid carcinomas and a variety of hematological malignancies, including atypical chronic myeloid leukemia and T-cell lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

