A25434
S100a9 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A25434
- Zusätzliche Namen:
- 60B8Ag|BEE22|Cagb|GAGB|L1Ag|MRP14|p14
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 13kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
- Uniprot:
- P31725
- Synonyme:
- 60B8A;60B8AG;AW546964;BEE22;Cag;CAGB;calgranulin B;Calgranulin-B;calprotectin L1H subunit;CFAG;CGLB;GAG;GAGB;L1;L1AG;leukocyte L1 complex heavy chain;LIAG;MAC387;MIF;migration inhibitory factor-related protein 14;MRP;MRP-14;MRP14;NIF;p1;P14;protein S100-A9;S100 calcium-binding protein A9;S100-A9
- Weitere Details:
- Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Involved in peptidyl-cysteine S-nitrosylation; positive regulation of blood coagulation; and regulation of translation. Acts upstream of or within several processes, including actin cytoskeleton reorganization; astrocyte development; and regulation of integrin biosynthetic process. Predicted to be located in cell junction; cytosol; and nucleoplasm. Predicted to be active in cytoplasm; extracellular space; and nucleus. Is expressed in several structures, including jaw; liver; otic capsule; skeleton; and spleen red pulp. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A9 (S100 calcium binding protein A9).
- Versandbedingungen:
- Blue Ice