GnRH1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25429
Zusätzliche Namen:: GNRH|GRH|LHRH|LNRH
Anwendung:: ELISA, WB
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Uniprot:: P01148
Synonyme:: GNRH;GnRH-associated peptide 1;gonadotropin-releasing hormone 1 (luteinizing-releasing hormone);GRH;leuteinizing-releasing hormone;LHRH;LNRH;luliberin I;Progonadoliberin I;progonadoliberin-1;prolactin release-inhibiting factor
Weitere Details:: This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.