A25426
SRGN Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25426
- Zusätzliche Namen:
- PPG|PRG|PRG1
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
- Uniprot:
- P10124
- Synonyme:
- hematopoetic proteoglycan core peptide;hematopoetic proteoglycan core protein;hematopoietic proteoglycan core protein;p.PG;platelet proteoglycan core protein;PPG;PRG;PRG1;proteoglycan 1, secretory granule;proteoglycan protein core for mast cell secretory granule;secretory granule proteoglycan core peptide;secretory granule proteoglycan core protein;serglycin;serglycin proteoglycan
- Weitere Details:
- This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.
- Versandbedingungen:
- Blue Ice



