CD34 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25367
Zusätzliche Namen:: CD34|CD34 molecule|GIG3|MORT1
Anwendung:: ELISA, Flow Cytometry, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKT
Uniprot:: Q64314
Synonyme:: AU040960;CD34 antigen;cluster designation 34;hematopoietic progenitor cell antigen CD34
Weitere Details:: Enables sulfate binding activity. Acts upstream of or within leukocyte migration. Located in cytoplasm; external side of plasma membrane; and extracellular region. Is expressed in several structures, including alimentary system; cardiovascular system; extraembryonic component; genitourinary system; and skin. Orthologous to human CD34 (CD34 molecule).