IL-17RB Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25361
Zusätzliche Namen:: CRL4|EVI27|IL17BR|IL17RH1
Anwendung:: ELISA, Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGG
Uniprot:: Q9NRM6
Synonyme:: CRL4;cytokine receptor CRL4;cytokine receptor-like 4;EVI27;IL-17 receptor B;IL-17 receptor homolog 1;IL-17B receptor;IL-17RB;IL-17Rh1;IL17BR;IL17RH1;interleukin 17 receptor homolog 1;interleukin-17 receptor B;interleukin-17B receptor
Weitere Details:: The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.