DKK3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2527
Zusätzliche Namen:: CRRL|DKK3|REIC|RIG
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMAT
Uniprot:: Q9UBP4
Synonyme:: dickkopf 3 homolog;dickkopf homolog 3;dickkopf-3;dickkopf-related protein 3;dkk-3;hDkk-3;regulated in glioma;REIC;RIG;RIG-like 5-6;RIG-like 7-1
Weitere Details:: This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein.