[KD Validated] LXR beta/NER Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25259
Zusätzliche Namen:: LXR-b|LXRB|NER|NER-I|NR1H2|RIP15|UNR
Anwendung:: ELISA, WB
Molekulargewicht:: 51kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYN
Uniprot:: P55055
Synonyme:: liver X nuclear receptor beta;Liver X receptor beta;LX receptor beta;LXR-b;LXRB;NER;NER-I;nuclear orphan receptor LXR-beta;nuclear receptor NER;Nuclear receptor subfamily 1 group H member 2;oxysterols receptor LXR-beta;RIP15;steroid hormone-nuclear receptor NER;ubiquitously-expressed nuclear receptor;UNR
Weitere Details:: The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).

Versandbedingungen:: Blue Ice