A25251
ID2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A25251
- Zusätzliche Namen:
- bHLHb26|GIG8|ID2|ID2A|ID2H
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR
- Uniprot:
- Q02363
- Synonyme:
- bHLHb26;cell growth-inhibiting gene 8;class B basic helix-loop-helix protein 26;DNA-binding protein inhibitor ID-2;DNA-binding protein inhibitor ID2;GIG8;helix-loop-helix protein ID2;ID2A;ID2H;inhibitor of differentiation 2;Inhibitor of DNA binding 2;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein;inhibitor of DNA binding 2, HLH protein
- Weitere Details:
- The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3.
- Versandbedingungen:
- Blue Ice