NKX2-2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25248
Zusätzliche Namen:: NKX2-2|NKX2.2|NKX2B
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPR
Uniprot:: O95096
Synonyme:: homeobox protein NK-2 homolog B;homeobox protein Nkx-2.2;NK2 transcription factor related, locus 2;NK2 transcription factor-like protein B;NKX2.2;NKX2B
Weitere Details:: The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.