A25244
MRPL36 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A25244
- Zusätzliche Namen:
- bL36m|BRIP1|L36mt|MRP-L36|PRPL36|RPMJ
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
- Uniprot:
- Q9P0J6
- Synonyme:
- 39S ribosomal protein L36, mitochondrial;BRCA1-interacting protein 1;BRIP1;L36mt;mitochondrial large ribosomal subunit protein bL36m;MRP-L36;PRPL36;putative BRCA1-interacting protein;RPMJ
- Weitere Details:
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 2p.
- Versandbedingungen:
- Blue Ice