Inhibin beta A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25230
Zusätzliche Namen:: EDF|FRP|Inhibin beta A (INHBA)
Anwendung:: ELISA, WB
Molekulargewicht:: 47kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGY
Uniprot:: P08476
Synonyme:: activin beta-A chain;EDF;erythroid differentiation factor;erythroid differentiation protein;follicle-stimulating hormone-releasing protein;FRP;FSH-releasing protein;inhibin beta A chain;inhibin beta A subunit;inhibin, beta A (activin A, activin AB alpha polypeptide);Inhibin, beta-1
Weitere Details:: This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients.