A2523
PSMA1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2523
- Zusätzliche Namen:
- HC2|HEL-S-275|NU|PROS30|PSMA1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
- Uniprot:
- P25786
- Synonyme:
- 30 kDa prosomal protein;epididymis secretory protein Li 275;HC2;HEL-S-275;macropain subunit C2;macropain subunit nu;multicatalytic endopeptidase complex subunit C2;NU;PROS-30;PROS30;proteasome (prosome, macropain) subunit, alpha type, 1;proteasome component C2;proteasome nu chain;proteasome subunit alpha 1;proteasome subunit alpha 6;proteasome subunit alpha type-1;proteasome subunit nu;proteasome subunit, alpha-type, 1;protein P30-33K;testicular tissue protein Li 150
- Weitere Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice



