A2522
ENPP2 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A2522
- Zusätzliche Namen:
- ATX|ATX-X|AUTOTAXIN|ENPP2|LysoPLD|NPP2|PD-IALPHA|PDNP2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110-115kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVSPSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLHTYESEI
- Uniprot:
- Q13822
- Synonyme:
- ATX;ATX-X;AUTOTAXIN;autotaxin-t;E-NPP 2;ectonucleotide pyrophosphatase/phosphodiesterase family member 2;extracellular lysophospholipase D;LysoPLD;NPP2;PD-IALPHA;PDNP2;phosphodiesterase I/nucleotide pyrophosphatase 2;plasma lysophospholipase D
- Weitere Details:
- The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice

