A25216
CXCR3-B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25216
- Zusätzliche Namen:
- CD182|CD183|CKR-L2|CMKAR3|CXCR3|GPR9|IP10-R|Mig-R|MigR
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSPFPPSQVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
- Uniprot:
- P49682-2
- Synonyme:
- C-X-C chemokine receptor type 3;CD182;CD183;chemokine (C-X-C motif) receptor 3;chemokine receptor 3;CKR-L2;CMKAR3;G protein-coupled receptor 9;GPR9;interferon-inducible protein 10 receptor;IP-10 receptor;IP10-R;Mig receptor;Mig-R;MigR
- Weitere Details:
- This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).
- Versandbedingungen:
- Blue Ice



