A25213
EAAT2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A25213
- Zusätzliche Namen:
- DEE41|EAAT2|EAAT2/SLC1A2|EIEE41|GLT-1|GLT1|HBGT
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
- Uniprot:
- P43004
- Synonyme:
- DEE41;EAAT2;EIEE41;excitatory amino acid transporter 2;excitotoxic amino acid transporter 2;GLT-1;glutamate/aspartate transporter II;HBGT;sodium-dependent glutamate/aspartate transporter 2;solute carrier family 1 (glial high affinity glutamate transporter), member 2;Solute carrier family 1 member 2
- Weitere Details:
- This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified.
- Versandbedingungen:
- Blue Ice








