A25185
B-Raf V600E Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A25185
- Zusätzliche Namen:
- B-raf|B-RAF1|BRAF-1|BRAF1|NS7|RAFB1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 85kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSG
- Uniprot:
- P15056
- Synonyme:
- 94 kDa B-raf protein;B-raf;B-Raf proto-oncogene serine/threonine-protein kinase (p94);B-Raf serine/threonine-protein;B-RAF1;BRAF1;murine sarcoma viral (v-raf) oncogene homolog B1;NS7;p94;proto-oncogene B-Raf;RAFB1;serine/threonine-protein kinase B-raf;v-raf murine sarcoma viral oncogene homolog B;v-raf murine sarcoma viral oncogene homolog B1
- Weitere Details:
- This gene encodes a protein belonging to the RAF family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERK signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene, most commonly the V600E mutation, are the most frequently identified cancer-causing mutations in melanoma, and have been identified in various other cancers as well, including non-Hodgkin lymphoma, colorectal cancer, thyroid carcinoma, non-small cell lung carcinoma, hairy cell leukemia and adenocarcinoma of lung. Mutations in this gene are also associated with cardiofaciocutaneous, Noonan, and Costello syndromes, which exhibit overlapping phenotypes. A pseudogene of this gene has been identified on the X chromosome.
- Versandbedingungen:
- Blue Ice