A25105
RPE65 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25105
- Zusätzliche Namen:
- BCO3|LCA2|mRPE65|p63|rd12|RP20|RPE65|sRPE65
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 66kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLN
- Uniprot:
- Q16518
- Synonyme:
- all-trans-retinyl-palmitate hydrolase;BCO family, member 3;BCO3;LCA2;lutein isomerase;meso-zeaxanthin isomerase;mRPE65;p63;RBP-binding membrane protein;rd12;retinal pigment epithelium specific protein 65;retinal pigment epithelium-specific 65 kDa protein;retinal pigment epithelium-specific protein 65kDa;retinitis pigmentosa 20 (autosomal recessive);retinoid isomerohydrolase;retinol isomerase;RP20;RPE65, retinoid isomerohydrolase;sRPE65
- Weitere Details:
- The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital.
- Versandbedingungen:
- Blue Ice

