A25055
CD23 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A25055
- Zusätzliche Namen:
- BLAST-2|CD23|CD23A|CLEC4J|FCE2|FCErII|IGEBF
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
- Uniprot:
- P06734
- Synonyme:
- BLAST-2;C-type lectin domain family 4 member J;C-type lectin domain family 4, member J;CD23;CD23 antigen;CD23A;CLEC4J;Fc epsilon receptor II;Fc fragment of IgE, low affinity II, receptor for (CD23);fc-epsilon-RII;FCE2;IGEBF;immunoglobulin E-binding factor;immunoglobulin epsilon-chain;low affinity immunoglobulin epsilon Fc receptor;lymphocyte IgE receptor
- Weitere Details:
- The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice



