A25053
DHX30 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25053
- Zusätzliche Namen:
- DDX30|DHX30|NEDMIAL|RETCOR
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 134kDa/140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RELGETQRRPCTIQVPEPILRKIETFLNHYPVESSWIAPELRLQSDDILPLGKDSGPLSDPITGKPYVPLLEAEEVRLSQSLLELWRRRGPVWQEAPQLPVDPHRDTILNAIEQHPVVVISGDTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQ
- Uniprot:
- Q7L2E3
- Synonyme:
- ATP-dependent RNA helicase DHX30;DDX30;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 30;DEAH (Asp-Glu-Ala-His) box helicase 30;DEAH (Asp-Glu-Ala-His) box polypeptide 30;DEAH box protein 30;DEAH-box helicase 30;NEDMIAL;putative ATP-dependent RNA helicase DHX30;RETCOR;retina co-repressor
- Weitere Details:
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The family member encoded by this gene is a mitochondrial nucleoid protein that associates with mitochondrial DNA. It has also been identified as a component of a transcriptional repressor complex that functions in retinal development, and it is required to optimize the function of the zinc-finger antiviral protein. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice

