Bcl-2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A25052
Zusätzliche Namen:: Bcl-2
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Rat
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
Uniprot:: P49950
Synonyme:: apoptosis regulator Bcl-2;B cell lymphoma 2 associated oncogene;B-cell CLL/lymphoma 2;B-cell leukemia/lymphoma 2;Bcl-2;Bcl-2alpha;Bcl2-like protein;PPP1R50;protein phosphatase 1, regulatory subunit 50
Weitere Details:: Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).

Versandbedingungen:: Blue Ice