CD146 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A25042
Zusätzliche Namen:: CD146|HEMCAM|MelCAM|METCAM|MUC18
Anwendung:: ELISA, WB
Molekulargewicht:: 120kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: STERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH
Uniprot:: P43121
Synonyme:: CD146;cell surface glycoprotein MUC18;cell surface glycoprotein P1H12;Gicerin;HEMCAM;melanoma adhesion molecule;Melanoma cell adhesion molecule;melanoma-associated antigen A32;melanoma-associated antigen MUC18;MelCAM;METCAM;MUC18;S-endo 1 endothelial-associated antigen
Weitere Details:: Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma.