A25041
FNDC5 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A25041
- Zusätzliche Namen:
- FNDC5|FRCP2|irisin
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
- Uniprot:
- Q8NAU1
- Synonyme:
- fibronectin type III domain-containing protein 5;fibronectin type III repeat-containing protein 2;FRCP2;irisin
- Weitere Details:
- This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice



