PLC gamma 2 (PLCG2) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25017
Zusätzliche Namen:: APLAID|FCAS3|PLC-gamma-2|PLC-IV
Anwendung:: ELISA, WB
Molekulargewicht:: 150kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVS
Uniprot:: P16885
Synonyme:: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2;APLAID;FCAS3;phosphoinositide phospholipase C-gamma-2;Phospholipase C-gamma-2;phospholipase C-IV;phospholipase C, gamma 2 (phosphatidylinositol-specific);PLC-gamma-2;PLC-IV
Weitere Details:: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.