A25014
CXCL1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A25014
- Zusätzliche Namen:
- CXCL1|Fsp|gro|Gro1|KC|Mgsa|N51|Scyb1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa (Recombinant Protein)
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
- Uniprot:
- P12850
- Synonyme:
- alpha-chemokine;C-X-C motif chemokine 1;chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha);F;fibroblast secretory protein;FSP;Gr;gro;GRO-alpha(1-73);GRO1;GRO1 oncogene;GRO1 oncogene (melanoma growth stimulating activity, alpha);GRO1 oncogene (melanoma growth-stimulating activity);GROa;growth-regulated alpha protein;KC;KC/GR)-alpha;KC/GRO-alpha;melanoma growth stimulating activity, alpha;melanoma growth stimulatory activity alpha;Mg;MGSA;MGSA alpha;MGSA-a;N5;N51;NAP-3;neutrophil-activating protein 3;platelet-derived growth factor-inducible protein KC;Scyb;SCYB1;secretory protein N51
- Weitere Details:
- This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
- Versandbedingungen:
- Blue Ice