[KD Validated] MCCC1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A25002
Zusätzliche Namen:: [KD Validated] MCCC1|MCC-B|MCCA|MCCCalpha
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE
Uniprot:: Q96RQ3
Synonyme:: 3-methylcrotonyl-CoA carboxylase 1;3-methylcrotonyl-CoA carboxylase biotin-containing subunit;3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha;MCC-B;MCCA;MCCase subunit alpha;MCCCalpha;methylcrotonoyl-CoA carboxylase 1 (alpha);methylcrotonoyl-CoA carboxylase alpha;methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial;methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)
Weitere Details:: This gene encodes the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.