A24994
IL-27RA/WSX-1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A24994
- Zusätzliche Namen:
- CRL1|IL-27RA|IL-27RA/WSX-1|IL27R|TCCR|WSX1|zcytor1
- Anwendung:
- ELISA, Flow Cytometry
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGIT
- Uniprot:
- Q6UWB1
- Synonyme:
- class I cytokine receptor;CRL1;cytokine receptor WSX-1;cytokine receptor-like 1;IL-27 receptor subunit alpha;IL-27R subunit alpha;IL-27R-alpha;IL-27RA;IL27R;interleukin 27 receptor, alpha;interleukin-27 receptor subunit alpha;T-cell cytokine receptor type 1;TCCR;type I T-cell cytokine receptor;WSX1;zcytor1
- Weitere Details:
- In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most antibody responses. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but are not absent of, Th1 or Th2 immune responses. This gene encodes a protein which is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level, and is predicted to be a glycosylated transmembrane protein.
- Versandbedingungen:
- Blue Ice