ABflo[R] 488 Rabbit anti-Mouse CD150/SLAM monoclonal antibody

Größe

Auf Anfrage

SKU:: A24971
Zusätzliche Namen:: 4933415F16|CD150|CDw150|ESTM51|IPO-3|Slam
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP
Uniprot:: Q9QUM4
Synonyme:: 4933415F16;AA177906;CD150;CDw150;ESTM5;ESTM51;IP;IPO-3;S;signaling lymphocyte activation molecule;signaling lymphocytic activation molecule;SLAM;SLAM family member 1
Weitere Details:: Enables identical protein binding activity and signaling receptor activity. Involved in natural killer cell activation; positive regulation of activated T cell proliferation; and regulation of cytokine production. Acts upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; positive regulation of leukocyte chemotaxis; and regulation of vesicle fusion. Located in external side of plasma membrane and phagocytic vesicle. Is expressed in liver lobe. Orthologous to human SLAMF1 (signaling lymphocytic activation molecule family member 1).