A24951
A Alpha-Synuclein Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A24951
- Zusätzliche Namen:
- NACP|PARK1|PARK4|PD1|A Alpha-Synuclein
- Anwendung:
- ELISA, WB, IF, ICC, IP
- Molekulargewicht:
- 18KDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Uniprot:
- P37840
- Synonyme:
- alpha-synuclein;I+/--synuclein;NACP;non A-beta component of AD amyloid;Non-A beta component of AD amyloid;Non-A4 component of amyloid precursor;PARK1;PARK4;PD1;synuclein alpha-140;synuclein, alpha (non A4 component of amyloid precursor);truncated alpha synuclein
- Weitere Details:
- Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
- Versandbedingungen:
- Blue Ice








