[KD Validated] RGAP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24948
Zusätzliche Namen:: [KD Validated] RGAP1|CDAN3B|CYK4|HsCYK-4|ID-GAP|MgcRacGAP
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 70-75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
Uniprot:: Q9H0H5
Synonyme:: CYK4;HsCYK-4;ID-GAP;male germ cell RacGap;MgcRacGAP;protein CYK4 homolog;rac GTPase-activating protein 1
Weitere Details:: This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12.