PU.1/SPI1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24910
Zusätzliche Namen:: AGM10|OF|PU.1|PU.1/SPI1|SFPI1|SPI-1|SPI-A
Anwendung:: ELISA, Flow Cytometry, WB, IHC-P, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPM
Uniprot:: P17947
Synonyme:: 31 kDa transforming protein;31 kDa-transforming protein;hematopoietic transcription factor PU.1;OF;PU.1;SFPI1;SPI-1;SPI-A;spleen focus forming virus (SFFV) proviral integration oncogene spi1;transcription factor PU.1
Weitere Details:: This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.