A2491
POLR2L Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2491
- Zusätzliche Namen:
- hRPB7.6|POLR2L|RBP10|RPABC5|RPB10|RPB10beta|RPB7.6
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 8kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
- Uniprot:
- P62875
- Synonyme:
- DNA-directed RNA polymerase III subunit L;DNA-directed RNA polymerases I, II, and III subunit RPABC5;hRPB7.6;polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa;polymerase (RNA) II subunit L;RBP10;RNA polymerase II 7.6 kDa subunit;RNA polymerase II subunit L;RNA polymerases I, II, and III subunit ABC5;RPABC5;RPB10;RPB10 homolog;RPB10beta;RPB7.6
- Weitere Details:
- This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases.
- Versandbedingungen:
- Blue Ice





