LHCGR Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24884
Zusätzliche Namen:: HHG|LCGR|LGR2|LH/CG-R|LH/CGR|LHCGR|LHR|LHRHR|LSH-R|lutropin-choriogonadotropic hormone receptor|ULG5
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 94kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
Uniprot:: P22888
Synonyme:: HHG;hypergonadotropic hypogonadism;LCGR;LGR2;LH/CG-R;LH/CGR;LHR;LHRHR;LSH-R;Luteinizing hormone receptor;lutropin-choriogonadotropic hormone receptor;lutropin/choriogonadotropin receptor;ULG5
Weitere Details:: This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia.