LAP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24875
Zusätzliche Namen:: CMD1T|LAP2|LEMD4|PRO0868|thymopoietin|TMPO|TP
Anwendung:: ELISA, WB
Molekulargewicht:: 39kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSS
Uniprot:: P42166, P42167
Synonyme:: CMD1T;lamina-associated polypeptide 2;LAP2;LEM domain containing 4;LEMD4;PRO0868;thymopoietin;Thymopoietin isoform alpha;Thymopoietin-related peptide isoform alpha;Thymopoietin-related peptide isoforms beta/gamma;Thymopoietin, isoforms beta/gamma;TP
Weitere Details:: The protein encoded by this gene resides in the nucleus and may play a role in the assembly of the nuclear lamina, and thus help maintain the structural organization of the nuclear envelope. It may function as a receptor for the attachment of lamin filaments to the inner nuclear membrane. Mutations in this gene are associated with dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.