MDA5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24868
Zusätzliche Namen:: AGS7|Hlcd|IDDM19|IFIH1|interferon induced with helicase C domain 1|MDA-5|MDA5|RLR-2|SGMRT1
Anwendung:: ELISA, WB
Molekulargewicht:: 135 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS
Uniprot:: Q9BYX4
Synonyme:: AGS7;CADM-140 autoantigen;clinically amyopathic dermatomyositis autoantigen 140 kDa;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide;helicard;helicase with 2 CARD domains;Hlcd;IDDM19;interferon-induced helicase C domain-containing protein 1;Interferon-induced with helicase C domain protein 1;MDA-5;MDA5;melanoma differentiation-associated gene 5;melanoma differentiation-associated protein 5;murabutide down-regulated protein;RIG-I-like receptor 2;RLR-2;RNA helicase-DEAD box protein 116;SGMRT1
Weitere Details:: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19.

Versandbedingungen:: Blue Ice