A24859
LHB Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24859
- Zusätzliche Namen:
- CGB4|HH23|LHB|LSH-B|LSH-beta|lutropin subunit beta
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 15-30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
- Uniprot:
- P01229
- Synonyme:
- CGB4;HH23;interstitial cell stimulating hormone, beta chain;LSH-B;LSH-beta;luteinizing hormone beta polypeptide;luteinizing hormone beta subunit;Luteinizing hormone subunit beta;lutropin beta chain;lutropin subunit beta
- Weitere Details:
- This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism.
- Versandbedingungen:
- Blue Ice





