A24835
PPARA Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24835
- Zusätzliche Namen:
- hPPAR|NR1C1|PPAR|PPARA|PPARalpha
- Anwendung:
- WB
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
- Uniprot:
- Q07869
- Synonyme:
- hPPAR;NR1C1;nuclear receptor subfamily 1 group C member 1;peroxisome proliferative activated receptor, alpha;peroxisome proliferator-activated nuclear receptor alpha variant 3;peroxisome proliferator-activated receptor alpha;PPAR;PPAR-alpha;PPARalpha
- Weitere Details:
- Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.
- Versandbedingungen:
- Blue Ice