A24832
STAT6 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24832
- Zusätzliche Namen:
- D12S1644|IL-4-STAT|signal transducer and activator of transcription 6|STAT6|STAT6B|STAT6C
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 94kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW
- Uniprot:
- P42226
- Synonyme:
- D12S1644;IL-4 Stat;IL-4-STAT;signal transducer and activator of transcription 6;signal transducer and activator of transcription 6, interleukin-4 induced;STAT, interleukin4-induced;STAT6B;STAT6C;transcription factor IL-4 STAT
- Weitere Details:
- The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

