ABflo[R] 488 Rabbit anti-Human BTN3A1/2/3 monoclonal antibody

Größe

Auf Anfrage

SKU:: A24821
Zusätzliche Namen:: BT3.1|BTF5|BTN3.1|CD277
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Uniprot:: O00478, O00481, P78410
Synonyme:: BT3.1;BT3.2;BTF3;BTF4;BTF5;BTN3.1;BTN3.2;BTN3.3;butyrophilin 3;butyrophilin protein;butyrophilin subfamily 3 member A1;butyrophilin subfamily 3 member A2;butyrophilin subfamily 3 member A3;CD277;dJ45P21.3 (butyrophilin, subfamily 3, member A1)
Weitere Details:: The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A1) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).

Versandbedingungen:: Blue Ice