![ABflo[R] 594 Rabbit anti-Human CD355/CRTAM monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A24820/A24820_1.jpg)
![ABflo[R] 594 Rabbit anti-Human CD355/CRTAM monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A24820/A24820_2.jpg)
![ABflo[R] 594 Rabbit anti-Human CD355/CRTAM monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A24820/A24820_ARC63867-01-ABf594-01(Red)i_FC_01.jpg)
![ABflo[R] 594 Rabbit anti-Human CD355/CRTAM monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A24820/A24820_ARC63867-01-ABf594-01(Red)i_FC_02.jpg)
A24820
ABflo[R] 594 Rabbit anti-Human CD355/CRTAM monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A24820
- Zusätzliche Namen:
- CD355
- Anwendung:
- Flow Cytometry
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- 2-8[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
- Uniprot:
- O95727
- Synonyme:
- CD355;class-I MHC-restricted T-cell-associated molecule;cytotoxic and regulatory T-cell molecule
- Weitere Details:
- The CRTAM gene is upregulated in CD4 (see MIM 186940)-positive and CD8 (see CD8A; MIM 186910)-positive T cells and encodes a type I transmembrane protein with V and C1-like Ig domains (Yeh et al., 2008 [PubMed 18329370]).
- Versandbedingungen:
- Blue Ice