[KD Validated] Sharpin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24809
Zusätzliche Namen:: [KD Validated] Sharpin|SIPL1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNG
Uniprot:: Q9H0F6
Synonyme:: hSIPL1;shank-associated RH domain-interacting protein;shank-interacting protein-like 1;sharpin;SIPL1
Weitere Details:: Enables polyubiquitin modification-dependent protein binding activity. Involved in protein linear polyubiquitination and regulation of signal transduction. Located in cytosol. Part of LUBAC complex.