SOX9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2479
Zusätzliche Namen:: CMD1|CMPD1|SOX9|SRA1|SRXX2|SRXY10
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQ
Uniprot:: P48436
Synonyme:: CMD1;CMPD1;SRA1;SRXX2;SRXY10;SRY (sex determining region Y)-box9;SRY (sex-determining region Y)-box 9 protein;SRY-box 9;SRY-related HMG-box, gene 9;transcription factor SOX-9
Weitere Details:: The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.