A24786
FDX1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24786
- Zusätzliche Namen:
- ADX|FDX|FDX1|ferredoxin 1|LOH11CR1D
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSM
- Uniprot:
- P10109
- Synonyme:
- adrenal ferredoxin;adrenodoxin, mitochondrial;ADX;FDX;Ferredoxin-1;hepatoredoxin;LOH11CR1D;mitochondrial adrenodoxin
- Weitere Details:
- This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21.
- Versandbedingungen:
- Blue Ice