A24783
GPAM Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24783
- Zusätzliche Namen:
- glycerol-3-phosphate acyltransferase|GPAM|GPAT|GPAT1|mitochondrial
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 90-93kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLE
- Uniprot:
- Q9HCL2
- Synonyme:
- glycerol-3-phosphate acyltransferase 1, mitochondrial;GPAT;GPAT-1;GPAT1
- Weitere Details:
- This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene.
- Versandbedingungen:
- Blue Ice