A24776
MRPL3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24776
- Zusätzliche Namen:
- COXPD9|mitochondrial ribosomal protein L3|MRL3|MRPL3|RPML3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 39kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA
- Uniprot:
- P09001
- Synonyme:
- 39S ribosomal protein L3, mitochondrial;COXPD9;L3mt;mitochondrial 60S ribosomal protein L3;mitochondrial large ribosomal subunit protein uL3m;MRL3;MRP-L3;RPML3
- Weitere Details:
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
- Versandbedingungen:
- Blue Ice