[KD Validated] MRPL11 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A24775
Zusätzliche Namen:: CGI-113|L11MT|mitochondrial ribosomal protein L11|MRP-L11|MRPL11
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK
Uniprot:: Q9Y3B7
Synonyme:: 39S ribosomal protein L11, mitochondrial;CGI-113;L11MT;mitochondrial large ribosomal subunit protein uL11m;MRP-L11
Weitere Details:: This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12.